TMED3 Antikörper (C-Term)

Produktnummer ABIN630470

Der Kaninchen Polyklonal anti-TMED3 Antikörper wird verwendet zum Nachweis von TMED3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TMED3 Antikörper (C-Term) (ABIN630470)

Target: TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMED3 Antikörper

Bindungsspezifität: C-Term

Spezifität: TMED3 antibody was raised against the C terminal of TMED3

Aufreinigung: Purified

Immunogen: TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED3 Blocking Peptide, (ABIN937525), is also available for use as a blocking control in assays to test for specificity of this TMED3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED3

Target: TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))

Andere Bezeichnung: TMED3

Hintergrund: The function of this gene remains unknown.

Molekulargewicht: 25 kDa (MW of target protein)