TMED3 Antikörper (C-Term)
-
- Target Alle TMED3 Antikörper anzeigen
- TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMED3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMED3 antibody was raised against the C terminal of TMED3
- Aufreinigung
- Purified
- Immunogen
- TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
- Top Product
- Discover our top product TMED3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMED3 Blocking Peptide, catalog no. 33R-2139, is also available for use as a blocking control in assays to test for specificity of this TMED3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))
- Andere Bezeichnung
- TMED3 (TMED3 Produkte)
- Synonyme
- wu:fb09b11 antikoerper, 1200002G13Rik antikoerper, AW546672 antikoerper, P24b antikoerper, TMED3 antikoerper, C15orf22 antikoerper, P24B antikoerper, p26 antikoerper, transmembrane p24 trafficking protein 3 antikoerper, transmembrane emp24 domain-containing protein 3 antikoerper, tmed3 antikoerper, LOC100220305 antikoerper, Tmed3 antikoerper, TMED3 antikoerper
- Hintergrund
- The function of this gene remains unknown.
- Molekulargewicht
- 25 kDa (MW of target protein)
-