Calmegin Antikörper (N-Term)

Produktnummer ABIN630467

Der Kaninchen Polyklonal Anti-Calmegin-Antikörper wurde für WB validiert. Er ist geeignet, Calmegin in Proben von Human zu detektieren.

Kurzübersicht für Calmegin Antikörper (N-Term) (ABIN630467)

Target: Calmegin (CLGN)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calmegin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Calmegin Antikörper

Bindungsspezifität: N-Term

Spezifität: Calmegin antibody was raised against the N terminal of CLGN

Aufreinigung: Purified

Immunogen: Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calmegin Blocking Peptide, (ABIN936124), is also available for use as a blocking control in assays to test for specificity of this Calmegin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLGN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calmegin

Target: Calmegin (CLGN)

Andere Bezeichnung: Calmegin

Hintergrund: Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility.

Molekulargewicht: 70 kDa (MW of target protein)