SLC43A3 Antikörper (N-Term)

Produktnummer ABIN630461

Produktdetails anti-SLC43A3 Antikörper

Target: SLC43A3 (Solute Carrier Family 43, Member 3 (SLC43A3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC43A3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: SLC43 A3 antibody was raised against the N terminal of SLC43 3

Aufreinigung: Purified

Immunogen: SLC43 A3 antibody was raised using the N terminal of SLC43 3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC43A3 Blocking Peptide, catalog no. 33R-5667, is also available for use as a blocking control in assays to test for specificity of this SLC43A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC43A3

Target: SLC43A3 (Solute Carrier Family 43, Member 3 (SLC43A3))

Andere Bezeichnung: SLC43A3 (SLC43A3 Produkte)

Synonyme: EEG1 antikoerper, FOAP-13 antikoerper, PRO1659 antikoerper, SEEEG-1 antikoerper, Eeg1 antikoerper, SLC43A3 antikoerper, zgc:136890 antikoerper, solute carrier family 43 member 3 antikoerper, solute carrier family 43, member 3 antikoerper, solute carrier family 43, member 3b antikoerper, SLC43A3 antikoerper, Slc43a3 antikoerper, slc43a3b antikoerper

Hintergrund: SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.

Molekulargewicht: 54 kDa (MW of target protein)