TYR Antikörper

Produktnummer ABIN630459

Dieser Anti-TYR-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von TYR in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für TYR Antikörper (ABIN630459)

Target: TYR (Tyrosinase (TYR))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TYR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TYR Antikörper

Aufreinigung: Purified

Immunogen: TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TYR Blocking Peptide, (ABIN937131), is also available for use as a blocking control in assays to test for specificity of this TYR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TYR

Target: TYR (Tyrosinase (TYR))

Andere Bezeichnung: TYR

Hintergrund: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.

Molekulargewicht: 58 kDa (MW of target protein)