TM9SF1 Antikörper (N-Term)

Produktnummer ABIN630456

Dieser Anti-TM9SF1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von TM9SF1 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für TM9SF1 Antikörper (N-Term) (ABIN630456)

Target: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TM9SF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TM9SF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: TM9 SF1 antibody was raised against the N terminal of TM9 F1

Aufreinigung: Purified

Immunogen: TM9 SF1 antibody was raised using the N terminal of TM9 F1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TM9SF1 Blocking Peptide, (ABIN937836), is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TM9SF1

Target: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Andere Bezeichnung: TM9SF1

Hintergrund: TM9SF1 may function as channel, small molecule transporter or receptor.

Molekulargewicht: 67 kDa (MW of target protein)