SULF2 Antikörper (C-Term)

Produktnummer ABIN630454

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SULF2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SULF2 Antikörper (C-Term) (ABIN630454)

Target: SULF2 (Sulfatase 2 (SULF2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SULF2 Antikörper

Bindungsspezifität: C-Term

Spezifität: SULF2 antibody was raised against the C terminal of SULF2

Aufreinigung: Purified

Immunogen: SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULF2 Blocking Peptide, (ABIN937604), is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULF2

Target: SULF2 (Sulfatase 2 (SULF2))

Andere Bezeichnung: SULF2

Hintergrund: Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.

Molekulargewicht: 98 kDa (MW of target protein)