SSR2 Antikörper

Produktnummer ABIN630453

Dieses Anti-SSR2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SSR2 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für SSR2 Antikörper (ABIN630453)

Target: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SSR2 Antikörper

Aufreinigung: Purified

Immunogen: SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SSR2 Blocking Peptide, (ABIN5616396), is also available for use as a blocking control in assays to test for specificity of this SSR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSR2

Target: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Andere Bezeichnung: SSR2

Hintergrund: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein (alpha-SSR or SSR1) and a 22 kDa glycoprotein (beta-SSR or SSR2).

Molekulargewicht: 20 kDa (MW of target protein)