SSR2 Antikörper

Produktnummer ABIN630453

Dieser Anti-SSR2 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von SSR2 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für SSR2 Antikörper (ABIN630453)

Target: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SSR2 Antikörper

Aufreinigung: Purified

Immunogen: SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SSR2 Blocking Peptide, (ABIN5616396), is also available for use as a blocking control in assays to test for specificity of this SSR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSR2

Target: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Andere Bezeichnung: SSR2

Hintergrund: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein (alpha-SSR or SSR1) and a 22 kDa glycoprotein (beta-SSR or SSR2).

Molekulargewicht: 20 kDa (MW of target protein)