UGT1A1 Antikörper (Middle Region)

Produktnummer ABIN630449

Produktdetails anti-UGT1A1 Antikörper

Target: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT1 A1 antibody was raised against the middle region of µgT1 1

Aufreinigung: Purified

Immunogen: UGT1 A1 antibody was raised using the middle region of µgT1 1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT1A1 Blocking Peptide, catalog no. 33R-1543, is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT1A1

Target: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Andere Bezeichnung: UGT1A1 (UGT1A1 Produkte)

Hintergrund: UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha