NPTN Antikörper (Middle Region)

Produktnummer ABIN630447

Dieser Anti-NPTN-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von NPTN in WB und IHC. Geeignet für Human, Ratte, Maus und Hund.

Kurzübersicht für NPTN Antikörper (Middle Region) (ABIN630447)

Target: NPTN (Neuroplastin (NPTN))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPTN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-NPTN Antikörper

Bindungsspezifität: Middle Region

Spezifität: Neuroplastin antibody was raised against the middle region of NPTN

Aufreinigung: Purified

Immunogen: Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neuroplastin Blocking Peptide, (ABIN5614974), is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NPTN

Target: NPTN (Neuroplastin (NPTN))

Andere Bezeichnung: Neuroplastin

Hintergrund: Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Regulation of long-term Neuronal Synaptic Plasticity