CYP2A13 Antikörper (C-Term)

Produktnummer ABIN630443

Der Kaninchen Polyklonal Anti-CYP2A13-Antikörper wurde für WB validiert. Er ist geeignet, CYP2A13 in Proben von Human zu detektieren.

Kurzübersicht für CYP2A13 Antikörper (C-Term) (ABIN630443)

Target: CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2A13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CYP2A13 Antikörper

Bindungsspezifität: C-Term

Spezifität: CYP2 A13 antibody was raised against the C terminal of CYP2 13

Aufreinigung: Purified

Immunogen: CYP2 A13 antibody was raised using the C terminal of CYP2 13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2A13 Blocking Peptide, (ABIN937498), is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2A13

Target: CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))

Andere Bezeichnung: CYP2A13

Hintergrund: CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.

Molekulargewicht: 54 kDa (MW of target protein)