IL-10RA Antikörper (N-Term)

Produktnummer ABIN630438

Produktdetails anti-IL-10RA Antikörper

Target: IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-10RA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IL10 R Alpha antibody was raised against the N terminal of IL10 A

Aufreinigung: Purified

Immunogen: IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-10RA

Target: IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))

Andere Bezeichnung: IL10R alpha (IL10RA Produkte)

Synonyme: IL10R1 antikoerper, IL10RA antikoerper, CD210 antikoerper, CD210a antikoerper, CDW210A antikoerper, HIL-10R antikoerper, IL-10R1 antikoerper, IL10R antikoerper, AW553859 antikoerper, CDw210 antikoerper, CDw210a antikoerper, Il10r antikoerper, mIL-10R antikoerper, interleukin 10 receptor subunit alpha antikoerper, interleukin 10 receptor, alpha antikoerper, IL10RA antikoerper, Il10ra antikoerper

Hintergrund: IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Growth Factor Binding