PPIB Antikörper

Produktnummer ABIN630436

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PPIB in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Hund.

Kurzübersicht für PPIB Antikörper (ABIN630436)

Target: PPIB (Cyclophilin B (PPIB))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PPIB Antikörper

Aufreinigung: Purified

Immunogen: PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIB Blocking Peptide, (ABIN938323), is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIB

Target: PPIB (Cyclophilin B (PPIB))

Andere Bezeichnung: PPIB

Hintergrund: PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Molekulargewicht: 24 kDa (MW of target protein)