PPIB Antikörper

Produktnummer ABIN630436

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PPIB in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Hund.

Kurzübersicht für PPIB Antikörper (ABIN630436)

Target: PPIB (Cyclophilin B (PPIB))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PPIB Antikörper

Aufreinigung: Purified

Immunogen: PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIB Blocking Peptide, (ABIN938323), is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIB

Target: PPIB (Cyclophilin B (PPIB))

Andere Bezeichnung: PPIB

Hintergrund: PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Molekulargewicht: 24 kDa (MW of target protein)