Glucuronidase beta Antikörper (C-Term)

Produktnummer ABIN630431

Produktdetails anti-Glucuronidase beta Antikörper

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glucuronidase beta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GUSB antibody was raised against the C terminal of GUSB

Aufreinigung: Purified

Immunogen: GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GUSB Blocking Peptide, catalog no. 33R-9662, is also available for use as a blocking control in assays to test for specificity of this GUSB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glucuronidase beta

Target: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Andere Bezeichnung: GUSB (GUSB Produkte)

Synonyme: GUSB antikoerper, beta-GUS antikoerper, gus antikoerper, BG antikoerper, MPS7 antikoerper, AI747421 antikoerper, Gur antikoerper, Gus antikoerper, Gus-r antikoerper, Gus-s antikoerper, Gus-t antikoerper, Gus-u antikoerper, Gut antikoerper, asd antikoerper, g antikoerper, Ac2-223 antikoerper, si:ch211-160e1.7 antikoerper, si:ct573103.7 antikoerper, glucuronidase beta antikoerper, beta-D-glucuronidase antikoerper, beta-glucuronidase antikoerper, beta glucuronidase antikoerper, glucuronidase, beta antikoerper, GUSB antikoerper, bglR antikoerper, SSO_RS14735 antikoerper, Glu antikoerper, Gusb antikoerper, gusb antikoerper

Hintergrund: GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process