SLC46A3 Antikörper (N-Term)

Produktnummer ABIN630428

Produktdetails anti-SLC46A3 Antikörper

Target: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC46A3 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: SLC46 A3 antibody was raised against the N terminal of SLC46 3

Aufreinigung: Purified

Immunogen: SLC46 A3 antibody was raised using the N terminal of SLC46 3 corresponding to a region with amino acids MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC46A3 Blocking Peptide, catalog no. 33R-6144, is also available for use as a blocking control in assays to test for specificity of this SLC46A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC46A3

Target: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Andere Bezeichnung: SLC46A3 (SLC46A3 Produkte)

Synonyme: SLC46A3 antikoerper, DKFZp469J2134 antikoerper, FKSG16 antikoerper, 1200006F02Rik antikoerper, RGD1307594 antikoerper, solute carrier family 46 member 3 antikoerper, solute carrier family 46, member 3 antikoerper, SLC46A3 antikoerper, slc46a3 antikoerper, Slc46a3 antikoerper

Hintergrund: The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)