SDF4 Antikörper (C-Term)

Produktnummer ABIN630423

Dieses Anti-SDF4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SDF4 in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für SDF4 Antikörper (C-Term) (ABIN630423)

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SDF4 Antikörper

Bindungsspezifität: C-Term

Spezifität: SDF4 antibody was raised against the C terminal of SDF4

Aufreinigung: Purified

Immunogen: SDF4 antibody was raised using the C terminal of SDF4 corresponding to a region with amino acids KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDF4 Blocking Peptide, (ABIN939995), is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDF4

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Andere Bezeichnung: SDF4

Hintergrund: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Molekulargewicht: 39 kDa (MW of target protein)