SLC35B1 Antikörper (C-Term)

Produktnummer ABIN630422

Der Kaninchen Polyklonal Anti-SLC35B1-Antikörper wurde für WB validiert. Er ist geeignet, SLC35B1 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für SLC35B1 Antikörper (C-Term) (ABIN630422)

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC35B1 Antikörper

Bindungsspezifität: C-Term

Spezifität: SLC35 B1 antibody was raised against the C terminal of SLC35 1

Aufreinigung: Purified

Immunogen: SLC35 B1 antibody was raised using the C terminal of SLC35 1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35B1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC35B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35B1

Target: SLC35B1 (Solute Carrier Family 35, Member B1 (SLC35B1))

Andere Bezeichnung: SLC35B1

Hintergrund: SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

Molekulargewicht: 35 kDa (MW of target protein)