TMEM8B Antikörper (Middle Region)

Produktnummer ABIN630419

Der Kaninchen Polyklonal Anti-TMEM8B-Antikörper wurde für WB und IHC validiert. Er ist geeignet, TMEM8B in Proben von Human, Maus, Hund und Ratte zu detektieren.

Kurzübersicht für TMEM8B Antikörper (Middle Region) (ABIN630419)

Target: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TMEM8B Antikörper

Bindungsspezifität: Middle Region

Spezifität: C9 ORF127 antibody was raised against the middle region of C9 rf127

Aufreinigung: Purified

Immunogen: C9 ORF127 antibody was raised using the middle region of C9 rf127 corresponding to a region with amino acids THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF127 Blocking Peptide, (ABIN5612545), is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF127 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM8B

Target: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Andere Bezeichnung: C9ORF127

Hintergrund: The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.

Molekulargewicht: 52 kDa (MW of target protein)