Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

GPR161 Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GPR161 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.
Produktnummer ABIN630418

Kurzübersicht für GPR161 Antikörper (N-Term) (ABIN630418)

Target

Alle GPR161 Antikörper anzeigen
GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Reaktivität

  • 48
  • 11
  • 7
  • 7
  • 7
  • 6
  • 6
  • 5
  • 5
  • 5
  • 1
  • 1
Human

Wirt

  • 46
  • 2
Kaninchen

Klonalität

  • 46
  • 2
Polyklonal

Konjugat

  • 22
  • 4
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser GPR161 Antikörper ist unkonjugiert

Applikation

  • 35
  • 14
  • 14
  • 13
  • 13
  • 9
  • 3
  • 2
  • 2
  • 1
Western Blotting (WB), Immunohistochemistry (IHC)
  • Bindungsspezifität

    • 15
    • 6
    • 5
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    GPR161 antibody was raised against the N terminal of GPR161

    Aufreinigung

    Purified

    Immunogen

    GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV
  • Applikationshinweise

    WB: 2.5 µg/mL, IHC: 4-8 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    GPR161 Blocking Peptide, (ABIN5613832), is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    GPR161 (G Protein-Coupled Receptor 161 (GPR161))

    Andere Bezeichnung

    GPR161

    Hintergrund

    GPR161 is orphan receptor.

    Molekulargewicht

    58 kDa (MW of target protein)

    Pathways

    cAMP Metabolic Process
Sie sind hier:
Chat with us!