CDH22 Antikörper (N-Term)

Produktnummer ABIN630407

Der Kaninchen Polyklonal Anti-CDH22-Antikörper wurde für WB validiert. Er ist geeignet, CDH22 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für CDH22 Antikörper (N-Term) (ABIN630407)

Target: CDH22 (Cadherin-Like 22 (CDH22))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDH22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDH22 Antikörper

Bindungsspezifität: N-Term

Spezifität: CDH22 antibody was raised against the N terminal of CDH22

Aufreinigung: Purified

Immunogen: CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH22 Blocking Peptide, (ABIN940426), is also available for use as a blocking control in assays to test for specificity of this CDH22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDH22

Target: CDH22 (Cadherin-Like 22 (CDH22))

Andere Bezeichnung: CDH22

Hintergrund: CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins.

Molekulargewicht: 73 kDa (MW of target protein)