TMEM8B Antikörper (C-Term)

Produktnummer ABIN630403

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM8B in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Hund und Ratte.

Kurzübersicht für TMEM8B Antikörper (C-Term) (ABIN630403)

Target: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM8B Antikörper

Bindungsspezifität: C-Term

Spezifität: C9 ORF127 antibody was raised against the C terminal Of C9 rf127

Aufreinigung: Purified

Immunogen: C9 ORF127 antibody was raised using the C terminal Of C9 rf127 corresponding to a region with amino acids FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF127 Blocking Peptide, (ABIN938357), is also available for use as a blocking control in assays to test for specificity of this C9ORF127 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF127 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM8B

Target: TMEM8B (Transmembrane Protein 8B (TMEM8B))

Andere Bezeichnung: C9ORF127

Hintergrund: Overexpression of C9orf127 can influence the distribution of the cell cycle in NPC cells and it also plays a role in cell adhesion modulation in NPC cells.

Molekulargewicht: 52 kDa (MW of target protein)