FAR1 Antikörper (N-Term)

Produktnummer ABIN630402

Produktdetails anti-FAR1 Antikörper

Target: FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MLSTD2 antibody was raised against the N terminal Of Mlstd2

Aufreinigung: Purified

Immunogen: MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLSTD2 Blocking Peptide, catalog no. 33R-5390, is also available for use as a blocking control in assays to test for specificity of this MLSTD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLSTD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAR1

Target: FAR1 (Fatty Acyl CoA Reductase 1 (FAR1))

Andere Bezeichnung: MLSTD2 (FAR1 Produkte)

Synonyme: MLSTD2 antikoerper, SDR10E1 antikoerper, 2600011M19Rik antikoerper, 2900034E22Rik antikoerper, 3732409C05Rik antikoerper, AI850429 antikoerper, Mlstd2 antikoerper, mlstd2 antikoerper, MQJ16.4 antikoerper, MQJ16_4 antikoerper, fatty acid reductase 1 antikoerper, fatty acyl-CoA reductase 1 antikoerper, fatty acyl CoA reductase 1 antikoerper, fatty acyl-CoA reductase 1 L homeolog antikoerper, fatty acid reductase 1 antikoerper, FAR1 antikoerper, Far1 antikoerper, far1.L antikoerper

Hintergrund: MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.

Molekulargewicht: 59 kDa (MW of target protein)