FAM55D Antikörper (C-Term)
Kurzübersicht für FAM55D Antikörper (C-Term) (ABIN630400)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- FAM55 D antibody was raised against the C terminal of FAM55
-
Aufreinigung
- Purified
-
Immunogen
- FAM55 D antibody was raised using the C terminal of FAM55 corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK
-
-
-
-
Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
FAM55D Blocking Peptide, (ABIN5613492), is also available for use as a blocking control in assays to test for specificity of this FAM55D antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))
-
Andere Bezeichnung
- FAM55D
-
Hintergrund
- The function of FAM55 protein is not widely studied, and is yet to be elucidated fully.
-
Molekulargewicht
- 60 kDa (MW of target protein)
Target
-