KIAA0494 Antikörper (N-Term)

Produktnummer ABIN630388

Produktdetails anti-KIAA0494 Antikörper

Target: KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIAA0494 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KIAA0494 antibody was raised against the N terminal of KIAA0494

Aufreinigung: Purified

Immunogen: KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA0494 Blocking Peptide, catalog no. 33R-2036, is also available for use as a blocking control in assays to test for specificity of this KIAA0494 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0494 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIAA0494

Target: KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))

Andere Bezeichnung: KIAA0494 (EFCAB14 Produkte)

Synonyme: KIAA0494 antikoerper, RP11-8J9.3 antikoerper, 4732418C07Rik antikoerper, MGC80252 antikoerper, DKFZp468F099 antikoerper, RGD1310351 antikoerper, EF-hand calcium binding domain 14 antikoerper, EF-hand calcium binding domain 14 S homeolog antikoerper, EFCAB14 antikoerper, Efcab14 antikoerper, efcab14.S antikoerper, efcab14 antikoerper

Hintergrund: KIAA0494 is involved in calcium ion binding.

Molekulargewicht: 55 kDa (MW of target protein)