LAPTM4A Antikörper (Middle Region)

Produktnummer ABIN630387

Der Kaninchen Polyklonal anti-LAPTM4A Antikörper (ABIN630387) detektiert spezifisch LAPTM4A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus, Ratte und Hund.

Kurzübersicht für LAPTM4A Antikörper (Middle Region) (ABIN630387)

Target: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAPTM4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LAPTM4A Antikörper

Bindungsspezifität: Middle Region

Spezifität: LAPTM4 A antibody was raised against the middle region of LAPTM4

Aufreinigung: Purified

Immunogen: LAPTM4 A antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAPTM4A Blocking Peptide, (ABIN5614415), is also available for use as a blocking control in assays to test for specificity of this LAPTM4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAPTM4A

Target: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Andere Bezeichnung: LAPTM4A

Hintergrund: LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined, however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Molekulargewicht: 27 kDa (MW of target protein)