SMPD2 Antikörper

Produktnummer ABIN630382

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SMPD2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SMPD2 Antikörper (ABIN630382)

Target: SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMPD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMPD2 Antikörper

Aufreinigung: Purified

Immunogen: SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMPD2 Blocking Peptide, (ABIN5616305), is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMPD2

Target: SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))

Andere Bezeichnung: SMPD2

Hintergrund: SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung