SMPD2 Antikörper
-
- Target Alle SMPD2 Antikörper anzeigen
- SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMPD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH
- Top Product
- Discover our top product SMPD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMPD2 Blocking Peptide, catalog no. 33R-8123, is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))
- Andere Bezeichnung
- SMPD2 (SMPD2 Produkte)
- Hintergrund
- SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung
-