CRELD1 Antikörper (C-Term)

Produktnummer ABIN630381

Produktdetails anti-CRELD1 Antikörper

Target: CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRELD1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Spezifität: CRELD1 antibody was raised against the C terminal of CRELD1

Aufreinigung: Purified

Immunogen: CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRELD1 Blocking Peptide, catalog no. 33R-9056, is also available for use as a blocking control in assays to test for specificity of this CRELD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRELD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRELD1

Target: CRELD1 (Cysteine-Rich with EGF-Like Domains 1 (CRELD1))

Andere Bezeichnung: CRELD1 (CRELD1 Produkte)

Synonyme: AVSD2 antikoerper, CIRRIN antikoerper, AI843811 antikoerper, cysteine rich with EGF like domains 1 antikoerper, cysteine-rich with EGF-like domains 1 antikoerper, CRELD1 antikoerper, Creld1 antikoerper

Hintergrund: Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Molekulargewicht: 45 kDa (MW of target protein)