RCE1/FACE2 Antikörper

Produktnummer ABIN630380

Der Kaninchen Polyklonal Anti-RCE1/FACE2-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RCE1/FACE2 in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für RCE1/FACE2 Antikörper (ABIN630380)

Target: RCE1/FACE2 (RCE1) (CAAX Prenyl Protease 2 (RCE1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RCE1/FACE2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RCE1/FACE2 Antikörper

Aufreinigung: Purified

Immunogen: RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RCE1 Blocking Peptide, (ABIN5615815), is also available for use as a blocking control in assays to test for specificity of this RCE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RCE1/FACE2

Target: RCE1/FACE2 (RCE1) (CAAX Prenyl Protease 2 (RCE1))

Andere Bezeichnung: RCE1

Hintergrund: RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.

Molekulargewicht: 36 kDa (MW of target protein)