ARMCX6 Antikörper (N-Term)

Produktnummer ABIN630378

Produktdetails anti-ARMCX6 Antikörper

Target: ARMCX6 (Armadillo Repeat Containing, X-Linked 6 (ARMCX6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARMCX6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ARMCX6 antibody was raised against the N terminal of ARMCX6

Aufreinigung: Purified

Immunogen: ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARMCX6 Blocking Peptide, catalog no. 33R-9198, is also available for use as a blocking control in assays to test for specificity of this ARMCX6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARMCX6

Target: ARMCX6 (Armadillo Repeat Containing, X-Linked 6 (ARMCX6))

Andere Bezeichnung: ARMCX6 (ARMCX6 Produkte)

Synonyme: AW060994 antikoerper, ARMCX6 antikoerper, MGC139912 antikoerper, armadillo repeat containing, X-linked 6 antikoerper, protein ARMCX6 antikoerper, ARMCX6 antikoerper, Armcx6 antikoerper, LOC100060676 antikoerper

Hintergrund: The function of ARMC protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)