SLC6A18 Antikörper (Middle Region)

Produktnummer ABIN630375

Dieses Anti-SLC6A18-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC6A18 in WB und IHC. Geeignet für Human, Ratte und Maus.

Kurzübersicht für SLC6A18 Antikörper (Middle Region) (ABIN630375)

Target: SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC6A18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC6A18 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC6 A18 antibody was raised against the middle region of SLC6 18

Aufreinigung: Purified

Immunogen: SLC6 A18 antibody was raised using the middle region of SLC6 18 corresponding to a region with amino acids MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A18 Blocking Peptide, (ABIN5616272), is also available for use as a blocking control in assays to test for specificity of this SLC6A18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC6A18

Target: SLC6A18 (Solute Carrier Family 6, Member 18 (SLC6A18))

Andere Bezeichnung: SLC6A18

Hintergrund: The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, amino acids, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions.

Molekulargewicht: 69 kDa (MW of target protein)