SLC35F5 Antikörper (C-Term)

Produktnummer ABIN630371

Produktdetails anti-SLC35F5 Antikörper

Target: SLC35F5 (Solute Carrier Family 35, Member F5 (SLC35F5))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35F5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC35 F5 antibody was raised against the C terminal of SLC35 5

Aufreinigung: Purified

Immunogen: SLC35 F5 antibody was raised using the C terminal of SLC35 5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35F5 Blocking Peptide, catalog no. 33R-9476, is also available for use as a blocking control in assays to test for specificity of this SLC35F5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35F5

Target: SLC35F5 (Solute Carrier Family 35, Member F5 (SLC35F5))

Andere Bezeichnung: SLC35F5 (SLC35F5 Produkte)

Synonyme: 1300003P13Rik antikoerper, AI646727 antikoerper, solute carrier family 35 member F5 antikoerper, solute carrier family 35, member F5 antikoerper, SLC35F5 antikoerper, Slc35f5 antikoerper

Hintergrund: SLC35F5 is a putative solute transporter.

Molekulargewicht: 59 kDa (MW of target protein)