SLC35F2 Antikörper (N-Term)

Produktnummer ABIN630368

Produktdetails anti-SLC35F2 Antikörper

Target: SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35F2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLC35 F2 antibody was raised against the N terminal of SLC35 2

Aufreinigung: Purified

Immunogen: SLC35 F2 antibody was raised using the N terminal of SLC35 2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35F2 Blocking Peptide, catalog no. 33R-5885, is also available for use as a blocking control in assays to test for specificity of this SLC35F2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35F2

Target: SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))

Andere Bezeichnung: SLC35F2 (SLC35F2 Produkte)

Synonyme: HSNOV1 antikoerper, 1500009K05Rik antikoerper, AU019213 antikoerper, solute carrier family 35 member F2 antikoerper, solute carrier family 35, member F2 antikoerper, SLC35F2 antikoerper, Slc35f2 antikoerper

Hintergrund: SLC35F2 is a putative solute transporter.

Molekulargewicht: 41 kDa (MW of target protein)