CLCC1 Antikörper (N-Term)

Produktnummer ABIN630362

Der Kaninchen Polyklonal Anti-CLCC1-Antikörper wurde für WB und IHC validiert. Er ist geeignet, CLCC1 in Proben von Human, Ratte, Maus und Hund zu detektieren.

Kurzübersicht für CLCC1 Antikörper (N-Term) (ABIN630362)

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLCC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CLCC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: CLCC1 antibody was raised against the N terminal of CLCC1

Aufreinigung: Purified

Immunogen: CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLCC1 Blocking Peptide, (ABIN5612913), is also available for use as a blocking control in assays to test for specificity of this CLCC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLCC1

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Andere Bezeichnung: CLCC1

Hintergrund: CLCC1 seems to act as a chloride ion channel.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom, Phosphorylierungen bei SARS-CoV-2 Infektion