FLJ22167 (N-Term) Antikörper

Produktnummer ABIN630360

Produktdetails

Target: FLJ22167

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: FLJ22167 antibody was raised against the N terminal of FLJ22167

Aufreinigung: Purified

Immunogen: FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ22167 Blocking Peptide, catalog no. 33R-1707, is also available for use as a blocking control in assays to test for specificity of this FLJ22167 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ22167 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ22167

Hintergrund: The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.

Molekulargewicht: 36 kDa (MW of target protein)