RNF121 Antikörper (N-Term)

Produktnummer ABIN630351

Dieses Anti-RNF121-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RNF121 in WB und IHC. Geeignet für Human, Ratte, Maus und Hund.

Kurzübersicht für RNF121 Antikörper (N-Term) (ABIN630351)

Target: RNF121 (Ring Finger Protein 121 (RNF121))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF121 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RNF121 Antikörper

Bindungsspezifität: N-Term

Spezifität: RNF121 antibody was raised against the N terminal of RNF121

Aufreinigung: Purified

Immunogen: RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF121 Blocking Peptide, (ABIN935996), is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF121

Target: RNF121 (Ring Finger Protein 121 (RNF121))

Andere Bezeichnung: RNF121

Hintergrund: The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling