UBE2J1 Antikörper

Produktnummer ABIN630349

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch UBE2J1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für UBE2J1 Antikörper (ABIN630349)

Target: UBE2J1 (Ubiquitin-Conjugating Enzyme E2, J1, U (UBE2J1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2J1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-UBE2J1 Antikörper

Aufreinigung: Purified

Immunogen: UBE2 J1 antibody was raised using a synthetic peptide corresponding to a region with amino acids METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2J1 Blocking Peptide, (ABIN5616869), is also available for use as a blocking control in assays to test for specificity of this UBE2J1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2J1

Target: UBE2J1 (Ubiquitin-Conjugating Enzyme E2, J1, U (UBE2J1))

Andere Bezeichnung: UBE2J1

Hintergrund: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.

Molekulargewicht: 35 kDa (MW of target protein)