S1PR5 Antikörper (N-Term)

Produktnummer ABIN630339

Dieses Anti-S1PR5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von S1PR5 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund, Drosophila melanogaster und Zebrafisch (Danio rerio).

Kurzübersicht für S1PR5 Antikörper (N-Term) (ABIN630339)

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser S1PR5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-S1PR5 Antikörper

Bindungsspezifität: N-Term

Spezifität: EDG8 antibody was raised against the N terminal of EDG8

Aufreinigung: Purified

Immunogen: EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EDG8 Blocking Peptide, (ABIN5613303), is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu S1PR5

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Andere Bezeichnung: EDG8

Hintergrund: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

Molekulargewicht: 16 kDa (MW of target protein)