S1PR5 Antikörper (N-Term)

Produktnummer ABIN630339

Dieser Anti-S1PR5 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von S1PR5 in WB und IHC. Geeignet für Human, Maus, Ratte, Hund, Drosophila melanogaster und Zebrafisch (Danio rerio).

Kurzübersicht für S1PR5 Antikörper (N-Term) (ABIN630339)

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Reaktivität: Human, Maus, Ratte, Hund, Drosophila melanogaster, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser S1PR5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-S1PR5 Antikörper

Bindungsspezifität: N-Term

Spezifität: EDG8 antibody was raised against the N terminal of EDG8

Aufreinigung: Purified

Immunogen: EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EDG8 Blocking Peptide, (ABIN5613303), is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu S1PR5

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Andere Bezeichnung: EDG8

Hintergrund: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

Molekulargewicht: 16 kDa (MW of target protein)