SEC63 Antikörper
Kurzübersicht für SEC63 Antikörper (ABIN630338)
Target
Alle SEC63 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Purified
-
Immunogen
- SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
-
-
-
-
Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
SEC63 Blocking Peptide, (ABIN935994), is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SEC63 (SEC63 Homolog (SEC63))
-
Andere Bezeichnung
- SEC63
-
Hintergrund
- The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.
-
Molekulargewicht
- 88 kDa (MW of target protein)
-
Pathways
- ER-Nucleus Signaling
Target
-