SEC63 Antikörper

Produktnummer ABIN630338

Der Kaninchen Polyklonal Anti-SEC63-Antikörper wurde für WB validiert. Er ist geeignet, SEC63 in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für SEC63 Antikörper (ABIN630338)

Target: SEC63 (SEC63 Homolog (SEC63))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEC63 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SEC63 Antikörper

Aufreinigung: Purified

Immunogen: SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEC63 Blocking Peptide, (ABIN935994), is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEC63

Target: SEC63 (SEC63 Homolog (SEC63))

Andere Bezeichnung: SEC63

Hintergrund: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling