SLC41A2 Antikörper (N-Term)
-
- Target Alle SLC41A2 Antikörper anzeigen
- SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC41A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC41 A2 antibody was raised against the N terminal of SLC41 2
- Aufreinigung
- Purified
- Immunogen
- SLC41 A2 antibody was raised using the N terminal of SLC41 2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
- Top Product
- Discover our top product SLC41A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC41A2 Blocking Peptide, catalog no. 33R-8340, is also available for use as a blocking control in assays to test for specificity of this SLC41A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))
- Andere Bezeichnung
- SLC41A2 (SLC41A2 Produkte)
- Synonyme
- MGC83802 antikoerper, slc41a1-l1 antikoerper, SLC41A1-L1 antikoerper, A230035L05Rik antikoerper, solute carrier family 41 member 2 antikoerper, solute carrier family 41 member 2 L homeolog antikoerper, solute carrier family 41, member 2 antikoerper, Slc41a2 antikoerper, slc41a2.L antikoerper, SLC41A2 antikoerper, slc41a2 antikoerper
- Hintergrund
- SLC41A2 acts as a plasma-membrane magnesium transporter.
- Molekulargewicht
- 53 kDa (MW of target protein)
-