Pannexin 2 Antikörper (N-Term)

Produktnummer ABIN630334

Produktdetails anti-Pannexin 2 Antikörper

Target: Pannexin 2 (PANX2)

Bindungsspezifität: N-Term

Reaktivität: Säugetier

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pannexin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Pannexin 2 antibody was raised against the N terminal of PANX2

Kreuzreaktivität: Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)

Aufreinigung: Purified

Immunogen: Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Pannexin 2 Blocking Peptide, catalog no. 33R-3625, is also available for use as a blocking control in assays to test for specificity of this Pannexin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pannexin 2

Target: Pannexin 2 (PANX2)

Andere Bezeichnung: Pannexin 2 (PANX2 Produkte)

Synonyme: PANX2 antikoerper, si:ch211-192n14.2 antikoerper, PX2 antikoerper, hPANX2 antikoerper, pannexin 2 antikoerper, PANX2 antikoerper, LOC100533356 antikoerper, panx2 antikoerper, Panx2 antikoerper

Hintergrund: PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.

Molekulargewicht: 70 kDa (MW of target protein)