VAMP5 Antikörper
-
- Target Alle VAMP5 Antikörper anzeigen
- VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VAMP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
- Top Product
- Discover our top product VAMP5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VAMP5 Blocking Peptide, catalog no. 33R-4142, is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))
- Andere Bezeichnung
- VAMP5 (VAMP5 Produkte)
- Hintergrund
- Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.
- Molekulargewicht
- 13 kDa (MW of target protein)
-