VAMP5 Antikörper

Produktnummer ABIN630333

Dieses Anti-VAMP5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von VAMP5 in WB. Geeignet für Human.

Kurzübersicht für VAMP5 Antikörper (ABIN630333)

Target: VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VAMP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VAMP5 Antikörper

Aufreinigung: Purified

Immunogen: VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VAMP5 Blocking Peptide, (ABIN939528), is also available for use as a blocking control in assays to test for specificity of this VAMP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAMP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VAMP5

Target: VAMP5 (Vesicle-Associated Membrane Protein 5 (Myobrevin) (VAMP5))

Andere Bezeichnung: VAMP5

Hintergrund: Synaptobrevins/VAMPs, syntaxins, and the 25 kDa synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. VAMP5 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.

Molekulargewicht: 13 kDa (MW of target protein)