Corin Antikörper (C-Term)

Produktnummer ABIN630332

Der Kaninchen Polyklonal Anti-Corin-Antikörper wurde für WB validiert. Er ist geeignet, Corin in Proben von Human zu detektieren.

Kurzübersicht für Corin Antikörper (C-Term) (ABIN630332)

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Corin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Corin Antikörper

Bindungsspezifität: C-Term

Spezifität: CORIN antibody was raised against the C terminal of CORIN

Aufreinigung: Purified

Immunogen: CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CORIN Blocking Peptide, (ABIN939203), is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CORIN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Corin

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Andere Bezeichnung: CORIN

Hintergrund: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Molekulargewicht: 74 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones