Reticulon 2 Antikörper (N-Term)

Produktnummer ABIN630331

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Reticulon 2 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für Reticulon 2 Antikörper (N-Term) (ABIN630331)

Target: Reticulon 2 (RTN2)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Reticulon 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Reticulon 2 Antikörper

Bindungsspezifität: N-Term

Spezifität: RTN2 antibody was raised against the N terminal of RTN2

Aufreinigung: Purified

Immunogen: RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RTN2 Blocking Peptide, (ABIN5615973), is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Reticulon 2

Target: Reticulon 2 (RTN2)

Andere Bezeichnung: RTN2

Hintergrund: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Molekulargewicht: 51 kDa (MW of target protein)