TMEM91 Antikörper (N-Term)

Produktnummer ABIN630330

Produktdetails anti-TMEM91 Antikörper

Target: TMEM91 (Transmembrane Protein 91 (TMEM91))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM91 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM91 antibody was raised against the N terminal of TMEM91

Aufreinigung: Purified

Immunogen: TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM91 Blocking Peptide, catalog no. 33R-8688, is also available for use as a blocking control in assays to test for specificity of this TMEM91 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM91 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM91

Target: TMEM91 (Transmembrane Protein 91 (TMEM91))

Andere Bezeichnung: TMEM91 (TMEM91 Produkte)

Synonyme: DSPC3 antikoerper, IFITMD6 antikoerper, A830041P22Rik antikoerper, transmembrane protein 91 antikoerper, TMEM91 antikoerper, Tmem91 antikoerper

Hintergrund: The function of TMEM91 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 15 kDa (MW of target protein)