SLC38A1 Antikörper (Middle Region)
-
- Target Alle SLC38A1 Antikörper anzeigen
- SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC38A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SLC38 A1 antibody was raised against the middle region of SLC38 1
- Aufreinigung
- Purified
- Immunogen
- SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD
- Top Product
- Discover our top product SLC38A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC38A1 Blocking Peptide, catalog no. 33R-2150, is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))
- Andere Bezeichnung
- SLC38A1 (SLC38A1 Produkte)
- Synonyme
- ATA1 antikoerper, NAT2 antikoerper, SAT1 antikoerper, SNAT1 antikoerper, AA408026 antikoerper, AA409865 antikoerper, AL022800 antikoerper, AU015942 antikoerper, Ata1 antikoerper, GlnT antikoerper, Sat1 antikoerper, solute carrier family 38 member 1 antikoerper, solute carrier family 38, member 1 antikoerper, SLC38A1 antikoerper, Slc38a1 antikoerper
- Hintergrund
- Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
- Molekulargewicht
- 58 kDa (MW of target protein)
-