SLC38A1 Antikörper (Middle Region)

Produktnummer ABIN630327

Dieses Anti-SLC38A1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC38A1 in WB und IHC. Geeignet für Human.

Kurzübersicht für SLC38A1 Antikörper (Middle Region) (ABIN630327)

Target: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC38A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC38A1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC38 A1 antibody was raised against the middle region of SLC38 1

Aufreinigung: Purified

Immunogen: SLC38 A1 antibody was raised using the middle region of SLC38 1 corresponding to a region with amino acids LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A1 Blocking Peptide, (ABIN940542), is also available for use as a blocking control in assays to test for specificity of this SLC38A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC38A1

Target: SLC38A1 (Solute Carrier Family 38 Member 1 (SLC38A1))

Andere Bezeichnung: SLC38A1

Hintergrund: Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Molekulargewicht: 54 kDa (MW of target protein)