Fukutin Antikörper (N-Term)

Produktnummer ABIN630326

Der Kaninchen Polyklonal Anti-Fukutin-Antikörper wurde für WB und IHC validiert. Er ist geeignet, Fukutin in Proben von Human, Ratte und Hund zu detektieren.

Kurzübersicht für Fukutin Antikörper (N-Term) (ABIN630326)

Target: Fukutin (FKTN)

Reaktivität: Human, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fukutin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-Fukutin Antikörper

Bindungsspezifität: N-Term

Spezifität: FKTN antibody was raised against the N terminal Of Fktn

Aufreinigung: Purified

Immunogen: FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKTN Blocking Peptide, (ABIN5613600), is also available for use as a blocking control in assays to test for specificity of this FKTN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fukutin

Target: Fukutin (FKTN)

Andere Bezeichnung: FKTN

Hintergrund: FKTN regulates the migration and assembly of neurons during cortical histogenesis. Fukuyama congenital muscular dystrophy results from mutations in its gene.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process