LETM1 Antikörper (Middle Region)

Produktnummer ABIN630325

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LETM1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für LETM1 Antikörper (Middle Region) (ABIN630325)

Target: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LETM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LETM1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LETM1 antibody was raised against the middle region of LETM1

Aufreinigung: Purified

Immunogen: LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LETM1 Blocking Peptide, (ABIN5614445), is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LETM1

Target: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Andere Bezeichnung: LETM1

Hintergrund: The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.

Molekulargewicht: 60 kDa (MW of target protein)