LETM1 Antikörper (Middle Region)

Produktnummer ABIN630325

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch LETM1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für LETM1 Antikörper (Middle Region) (ABIN630325)

Target: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LETM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LETM1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LETM1 antibody was raised against the middle region of LETM1

Aufreinigung: Purified

Immunogen: LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LETM1 Blocking Peptide, (ABIN5614445), is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LETM1

Target: LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))

Andere Bezeichnung: LETM1

Hintergrund: The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.

Molekulargewicht: 60 kDa (MW of target protein)