LY6G6F Antikörper (N-Term)
-
- Target Alle LY6G6F Antikörper anzeigen
- LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LY6G6F Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- C6 ORF21 antibody was raised against the N terminal Of C6 rf21
- Aufreinigung
- Purified
- Immunogen
- C6 ORF21 antibody was raised using the N terminal Of C6 rf21 corresponding to a region with amino acids CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED
- Top Product
- Discover our top product LY6G6F Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C6ORF21 Blocking Peptide, catalog no. 33R-1813, is also available for use as a blocking control in assays to test for specificity of this C6ORF21 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF21 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))
- Andere Bezeichnung
- C6ORF21 (LY6G6F Produkte)
- Synonyme
- C6orf21 antikoerper, G6f antikoerper, LY6G6D antikoerper, NG32 antikoerper, CJ068215 antikoerper, C6ORF21 antikoerper, lymphocyte antigen 6 family member G6F antikoerper, lymphocyte antigen 6 complex, locus G6F antikoerper, LY6G6F antikoerper, Ly6g6f antikoerper
- Hintergrund
- C6ORF21 may play a role in the downstream signal transduction pathways involving GRB2 and GRB7.
- Molekulargewicht
- 31 kDa (MW of target protein)
-