NrCAM Antikörper (N-Term)

Produktnummer ABIN630314

Der Kaninchen Polyklonal Anti-NrCAM Antikörper wurde für WB und IHC validiert. Er ist geeignet, NrCAM in Proben von Human zu detektieren.

Kurzübersicht für NrCAM Antikörper (N-Term) (ABIN630314)

Target: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NrCAM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-NrCAM Antikörper

Bindungsspezifität: N-Term

Spezifität: NRCAM antibody was raised against the N terminal of NRCAM

Aufreinigung: Purified

Immunogen: NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRCAM Blocking Peptide, (ABIN5615060), is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NrCAM

Target: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Andere Bezeichnung: NRCAM

Hintergrund: Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

Molekulargewicht: 141 kDa (MW of target protein)

Pathways: Regulation of Cell Size