SLC25A29 Antikörper (C-Term)

Produktnummer ABIN630313

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SLC25A29 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für SLC25A29 Antikörper (C-Term) (ABIN630313)

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A29 Antikörper

Bindungsspezifität: C-Term

Spezifität: SLC25 A29 antibody was raised against the C terminal of SLC25 29

Aufreinigung: Purified

Immunogen: SLC25 A29 antibody was raised using the C terminal of SLC25 29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A29 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A29

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Andere Bezeichnung: SLC25A29

Hintergrund: SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.

Molekulargewicht: 33 kDa (MW of target protein)